Anti DNPEP pAb (ATL-HPA044860 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA044860-25
  • Immunohistochemical staining of human cerebral cortex, lymph node, pancreas and testis using Anti-DNPEP antibody HPA044860 (A) shows similar protein distribution across tissues to independent antibody HPA036398 (B).
  • Immunofluorescent staining of human cell line MCF7 shows localization to cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aspartyl aminopeptidase
Gene Name: DNPEP
Alternative Gene Name: ASPEP, DAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026209: 92%, ENSRNOG00000019772: 91%
Entrez Gene ID: 23549
Uniprot ID: Q9ULA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen FDRDLTLAGRVIVKCPTSGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEPGPLNAVDER
Gene Sequence FDRDLTLAGRVIVKCPTSGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEPGPLNAVDER
Gene ID - Mouse ENSMUSG00000026209
Gene ID - Rat ENSRNOG00000019772
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNPEP pAb (ATL-HPA044860 w/enhanced validation)
Datasheet Anti DNPEP pAb (ATL-HPA044860 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DNPEP pAb (ATL-HPA044860 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DNPEP pAb (ATL-HPA044860 w/enhanced validation)
Datasheet Anti DNPEP pAb (ATL-HPA044860 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DNPEP pAb (ATL-HPA044860 w/enhanced validation)