Anti DNMT3L pAb (ATL-HPA055234)

Atlas Antibodies

Catalog No.:
ATL-HPA055234-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: DNA (cytosine-5-)-methyltransferase 3-like
Gene Name: DNMT3L
Alternative Gene Name: MGC1090
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000730: 63%, ENSRNOG00000001212: 66%
Entrez Gene ID: 29947
Uniprot ID: Q9UJW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKVHAMSNWVCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVL
Gene Sequence GKVHAMSNWVCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVL
Gene ID - Mouse ENSMUSG00000000730
Gene ID - Rat ENSRNOG00000001212
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNMT3L pAb (ATL-HPA055234)
Datasheet Anti DNMT3L pAb (ATL-HPA055234) Datasheet (External Link)
Vendor Page Anti DNMT3L pAb (ATL-HPA055234) at Atlas Antibodies

Documents & Links for Anti DNMT3L pAb (ATL-HPA055234)
Datasheet Anti DNMT3L pAb (ATL-HPA055234) Datasheet (External Link)
Vendor Page Anti DNMT3L pAb (ATL-HPA055234)