Anti DNMT3A pAb (ATL-HPA026588)

Atlas Antibodies

SKU: ATL-HPA026588-25

• 
• 

Protein Description: DNA (cytosine-5-)-methyltransferase 3 alpha
Gene Name: DNMT3A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020661: 91%, ENSRNOG00000026649: 91%
Entrez Gene ID: 1788
Uniprot ID: Q9Y6K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVEE
• Gene Sequence: LPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVEE
• Gene ID - Mouse: ENSMUSG00000020661
• Gene ID - Rat: ENSRNOG00000026649
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DNMT3A pAb (ATL-HPA026588) – 4 Found

Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759. 

Babu, Govind; Chaudhuri, Padmaparna; Rajappa, Manoj; Biswas, Manjusha; Sansar, Bipinesh; Rajegowda, Chethan; Radhakrishnan, Aneesha; Advani, Jayshree; Tewary, Biplab; Radhakrishnan, Padhma; Thiyagarajan, Saravanan; Chatterjee, Aditi; Upadhayaya, Ram Shankar; Majumder, Pradip K. JAK-STAT inhibitor as a potential therapeutic opportunity in AML patients resistant to cytarabine and epigenetic therapy. Cancer Biology & Therapy. 2021;22(1):66-78. 

Xu, Sunwang; Jiang, Cen; Lin, Ruirong; Wang, Xiaopeng; Hu, Xiaoqiang; Chen, Wei; Chen, Xiangjin; Chen, Tao. Epigenetic activation of the elongator complex sensitizes gallbladder cancer to gemcitabine therapy. Journal Of Experimental & Clinical Cancer Research : Cr. 2021;40(1):373. 

Xie, Zucheng; Dang, Yiwu; Wu, Huayu; He, Rongquan; Ma, Jie; Peng, Zhigang; Rong, Minhua; Li, Zhekun; Yang, Jiapeng; Jiang, Yizhao; Chen, Gang; Yang, Lihua. Effect of CELSR3 on the Cell Cycle and Apoptosis of Hepatocellular Carcinoma Cells. Journal Of Cancer. 11(10):2830-2844.