Anti DNMT1 pAb (ATL-HPA002694 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002694-25

Protein Description: DNA (cytosine-5-)-methyltransferase 1
Gene Name: DNMT1
Alternative Gene Name: CXXC9, DNMT, MCMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004099: 85%, ENSRNOG00000039859: 86%
Entrez Gene ID: 1786
Uniprot ID: P26358
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVL
• Gene Sequence: IPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVL
• Gene ID - Mouse: ENSMUSG00000004099
• Gene ID - Rat: ENSRNOG00000039859
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DNMT1 pAb (ATL-HPA002694 w/enhanced validation) – 3 Found

Chomyk, Anthony M; Volsko, Christina; Tripathi, Ajai; Deckard, Sadie A; Trapp, Bruce D; Fox, Robert J; Dutta, Ranjan. DNA methylation in demyelinated multiple sclerosis hippocampus. Scientific Reports. 2017;7(1):8696. 

Lin, Jianqing; Haffner, Michael C; Zhang, Yonggang; Lee, Byron H; Brennen, W Nathaniel; Britton, Justin; Kachhap, Sushant K; Shim, Joong Sup; Liu, Jun O; Nelson, William G; Yegnasubramanian, Srinivasan; Carducci, Michael A. Disulfiram is a DNA demethylating agent and inhibits prostate cancer cell growth. The Prostate. 2011;71(4):333-43. 

Xiong, Yujing; Hu, Linli; Zhang, Tao; Wang, Mengying; Xu, Hui; Li, Tin Chiu; Sun, Yingpu; Wang, Chi Chiu. Effects of high progesterone in in-vitro fertilization cycle on DNA methylation and gene expression of adhesion molecules on endometrium during implantation window. Journal Of Assisted Reproduction And Genetics. 2020;37(1):33-43.