Anti DNMT1 pAb (ATL-HPA002694 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002694-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: DNMT1
Alternative Gene Name: CXXC9, DNMT, MCMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004099: 85%, ENSRNOG00000039859: 86%
Entrez Gene ID: 1786
Uniprot ID: P26358
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVL |
| Gene Sequence | IPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVL |
| Gene ID - Mouse | ENSMUSG00000004099 |
| Gene ID - Rat | ENSRNOG00000039859 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNMT1 pAb (ATL-HPA002694 w/enhanced validation) | |
| Datasheet | Anti DNMT1 pAb (ATL-HPA002694 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNMT1 pAb (ATL-HPA002694 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DNMT1 pAb (ATL-HPA002694 w/enhanced validation) | |
| Datasheet | Anti DNMT1 pAb (ATL-HPA002694 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNMT1 pAb (ATL-HPA002694 w/enhanced validation) |
| Citations for Anti DNMT1 pAb (ATL-HPA002694 w/enhanced validation) – 3 Found |
| Chomyk, Anthony M; Volsko, Christina; Tripathi, Ajai; Deckard, Sadie A; Trapp, Bruce D; Fox, Robert J; Dutta, Ranjan. DNA methylation in demyelinated multiple sclerosis hippocampus. Scientific Reports. 2017;7(1):8696. PubMed |
| Lin, Jianqing; Haffner, Michael C; Zhang, Yonggang; Lee, Byron H; Brennen, W Nathaniel; Britton, Justin; Kachhap, Sushant K; Shim, Joong Sup; Liu, Jun O; Nelson, William G; Yegnasubramanian, Srinivasan; Carducci, Michael A. Disulfiram is a DNA demethylating agent and inhibits prostate cancer cell growth. The Prostate. 2011;71(4):333-43. PubMed |
| Xiong, Yujing; Hu, Linli; Zhang, Tao; Wang, Mengying; Xu, Hui; Li, Tin Chiu; Sun, Yingpu; Wang, Chi Chiu. Effects of high progesterone in in-vitro fertilization cycle on DNA methylation and gene expression of adhesion molecules on endometrium during implantation window. Journal Of Assisted Reproduction And Genetics. 2020;37(1):33-43. PubMed |