Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA039324-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: dynamin 1-like
Gene Name: DNM1L
Alternative Gene Name: DRP1, DVLP, DYMPLE, HDYNIV, VPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022789: 90%, ENSRNOG00000001813: 85%
Entrez Gene ID: 10059
Uniprot ID: O00429
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE
Gene Sequence EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE
Gene ID - Mouse ENSMUSG00000022789
Gene ID - Rat ENSRNOG00000001813
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation)
Datasheet Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation)
Datasheet Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation)
Citations for Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) – 2 Found
Jing, Ren; Hu, Zhao-Kun; Lin, Fei; He, Sheng; Zhang, Sui-Sui; Ge, Wan-Yun; Dai, Hui-Jun; Du, Xue-Ke; Lin, Jin-Yuan; Pan, Ling-Hui. Mitophagy-Mediated mtDNA Release Aggravates Stretching-Induced Inflammation and Lung Epithelial Cell Injury via the TLR9/MyD88/NF-κB Pathway. Frontiers In Cell And Developmental Biology. 8( 33015037):819.  PubMed
Simpson, Cory L; Tokito, Mariko K; Uppala, Ranjitha; Sarkar, Mrinal K; Gudjonsson, Johann E; Holzbaur, Erika L F. NIX initiates mitochondrial fragmentation via DRP1 to drive epidermal differentiation. Cell Reports. 2021;34(5):108689.  PubMed