Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039324-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DNM1L
Alternative Gene Name: DRP1, DVLP, DYMPLE, HDYNIV, VPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022789: 90%, ENSRNOG00000001813: 85%
Entrez Gene ID: 10059
Uniprot ID: O00429
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE |
Gene Sequence | EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE |
Gene ID - Mouse | ENSMUSG00000022789 |
Gene ID - Rat | ENSRNOG00000001813 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) | |
Datasheet | Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) | |
Datasheet | Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) |
Citations for Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) – 2 Found |
Jing, Ren; Hu, Zhao-Kun; Lin, Fei; He, Sheng; Zhang, Sui-Sui; Ge, Wan-Yun; Dai, Hui-Jun; Du, Xue-Ke; Lin, Jin-Yuan; Pan, Ling-Hui. Mitophagy-Mediated mtDNA Release Aggravates Stretching-Induced Inflammation and Lung Epithelial Cell Injury via the TLR9/MyD88/NF-κB Pathway. Frontiers In Cell And Developmental Biology. 8( 33015037):819. PubMed |
Simpson, Cory L; Tokito, Mariko K; Uppala, Ranjitha; Sarkar, Mrinal K; Gudjonsson, Johann E; Holzbaur, Erika L F. NIX initiates mitochondrial fragmentation via DRP1 to drive epidermal differentiation. Cell Reports. 2021;34(5):108689. PubMed |