Anti DNLZ pAb (ATL-HPA062738)

Atlas Antibodies

Catalog No.:
ATL-HPA062738-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DNL-type zinc finger
Gene Name: DNLZ
Alternative Gene Name: bA413M3.2, C9orf151, HEP, RP11-413M3.2, TIMM15, ZIM17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075467: 64%, ENSRNOG00000018791: 70%
Entrez Gene ID: 728489
Uniprot ID: Q5SXM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGE
Gene Sequence LGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGE
Gene ID - Mouse ENSMUSG00000075467
Gene ID - Rat ENSRNOG00000018791
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNLZ pAb (ATL-HPA062738)
Datasheet Anti DNLZ pAb (ATL-HPA062738) Datasheet (External Link)
Vendor Page Anti DNLZ pAb (ATL-HPA062738) at Atlas Antibodies

Documents & Links for Anti DNLZ pAb (ATL-HPA062738)
Datasheet Anti DNLZ pAb (ATL-HPA062738) Datasheet (External Link)
Vendor Page Anti DNLZ pAb (ATL-HPA062738)