Anti DNHD1 pAb (ATL-HPA039698)

Atlas Antibodies

Catalog No.:
ATL-HPA039698-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dynein heavy chain domain 1
Gene Name: DNHD1
Alternative Gene Name: C11orf47, CCDC35, DHCD1, DKFZp686J0796, DNHD1L, FLJ32752, FLJ35709, FLJ46184
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030882: 73%, ENSRNOG00000051291: 76%
Entrez Gene ID: 144132
Uniprot ID: Q96M86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KHSQATQPMLILLPPPGHPSATLHPLTVIQKLAAKYQQGQKQLQVIALGSEAWDPVSVVVSTLSQAMYEGHWLVLDNCHLMPHW
Gene Sequence KHSQATQPMLILLPPPGHPSATLHPLTVIQKLAAKYQQGQKQLQVIALGSEAWDPVSVVVSTLSQAMYEGHWLVLDNCHLMPHW
Gene ID - Mouse ENSMUSG00000030882
Gene ID - Rat ENSRNOG00000051291
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNHD1 pAb (ATL-HPA039698)
Datasheet Anti DNHD1 pAb (ATL-HPA039698) Datasheet (External Link)
Vendor Page Anti DNHD1 pAb (ATL-HPA039698) at Atlas Antibodies

Documents & Links for Anti DNHD1 pAb (ATL-HPA039698)
Datasheet Anti DNHD1 pAb (ATL-HPA039698) Datasheet (External Link)
Vendor Page Anti DNHD1 pAb (ATL-HPA039698)