Anti DNASE1L1 pAb (ATL-HPA072635)

Atlas Antibodies

Catalog No.:
ATL-HPA072635-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: deoxyribonuclease I-like 1
Gene Name: DNASE1L1
Alternative Gene Name: DNAS1L1, DNASEX, DNL1L, XIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019088: 77%, ENSRNOG00000055641: 75%
Entrez Gene ID: 1774
Uniprot ID: P49184
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GFHWVIADGEDTTVRASTHCTYDRVVLHGERCRSLLHTAAAFDFPTSFQLTEEEALNISDH
Gene Sequence GFHWVIADGEDTTVRASTHCTYDRVVLHGERCRSLLHTAAAFDFPTSFQLTEEEALNISDH
Gene ID - Mouse ENSMUSG00000019088
Gene ID - Rat ENSRNOG00000055641
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNASE1L1 pAb (ATL-HPA072635)
Datasheet Anti DNASE1L1 pAb (ATL-HPA072635) Datasheet (External Link)
Vendor Page Anti DNASE1L1 pAb (ATL-HPA072635) at Atlas Antibodies

Documents & Links for Anti DNASE1L1 pAb (ATL-HPA072635)
Datasheet Anti DNASE1L1 pAb (ATL-HPA072635) Datasheet (External Link)
Vendor Page Anti DNASE1L1 pAb (ATL-HPA072635)