Anti DNALI1 pAb (ATL-HPA028305)

Atlas Antibodies

SKU: ATL-HPA028305-25

• 

Protein Description: dynein, axonemal, light intermediate chain 1
Gene Name: DNALI1
Alternative Gene Name: dJ423B22.5, hp28, P28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042707: 75%, ENSRNOG00000024957: 78%
Entrez Gene ID: 7802
Uniprot ID: O14645
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPPKTKLPSTPCVPDPTKQ
• Gene Sequence: CWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPPKTKLPSTPCVPDPTKQ
• Gene ID - Mouse: ENSMUSG00000042707
• Gene ID - Rat: ENSRNOG00000024957
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DNALI1 pAb (ATL-HPA028305) – 8 Found

Hawkins, Finn J; Suzuki, Shingo; Beermann, Mary Lou; Barillà, Cristina; Wang, Ruobing; Villacorta-Martin, Carlos; Berical, Andrew; Jean, J C; Le Suer, Jake; Matte, Taylor; Simone-Roach, Chantelle; Tang, Yang; Schlaeger, Thorsten M; Crane, Ana M; Matthias, Nadine; Huang, Sarah X L; Randell, Scott H; Wu, Joshua; Spence, Jason R; Carraro, Gianni; Stripp, Barry R; Rab, Andras; Sorsher, Eric J; Horani, Amjad; Brody, Steven L; Davis, Brian R; Kotton, Darrell N. Derivation of Airway Basal Stem Cells from Human Pluripotent Stem Cells. Cell Stem Cell. 2021;28(1):79-95.e8. 

Lu, Chenyang; Yang, Danhui; Lei, Cheng; Wang, Rongchun; Guo, Ting; Luo, Hong. Identification of Two Novel DNAAF2 Variants in Two Consanguineous Families with Primary Ciliary Dyskinesia. Pharmacogenomics And Personalized Medicine. 14( 34785929):1415-1423. 

Onoufriadis, Alexandros; Shoemark, Amelia; Schmidts, Miriam; Patel, Mitali; Jimenez, Gina; Liu, Hui; Thomas, Biju; Dixon, Mellisa; Hirst, Robert A; Rutman, Andrew; Burgoyne, Thomas; Williams, Christopher; Scully, Juliet; Bolard, Florence; Lafitte, Jean-Jacques; Beales, Philip L; Hogg, Claire; Yang, Pinfen; Chung, Eddie M K; Emes, Richard D; O'Callaghan, Christopher; Bouvagnet, Patrice; Mitchison, Hannah M. Targeted NGS gene panel identifies mutations in RSPH1 causing primary ciliary dyskinesia and a common mechanism for ciliary central pair agenesis due to radial spoke defects. Human Molecular Genetics. 2014;23(13):3362-74. 

Dong, Frederick N; Amiri-Yekta, Amir; Martinez, Guillaume; Saut, Antoine; Tek, Julie; Stouvenel, Laurence; Lorès, Patrick; Karaouzène, Thomas; Thierry-Mieg, Nicolas; Satre, Véronique; Brouillet, Sophie; Daneshipour, Abbas; Hosseini, Seyedeh Hanieh; Bonhivers, Mélanie; Gourabi, Hamid; Dulioust, Emmanuel; Arnoult, Christophe; Touré, Aminata; Ray, Pierre F; Zhao, Haiqing; Coutton, Charles. Absence of CFAP69 Causes Male Infertility due to Multiple Morphological Abnormalities of the Flagella in Human and Mouse. American Journal Of Human Genetics. 2018;102(4):636-648. 

Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) 

Guo, Ting; Lu, Chenyang; Yang, Danhui; Lei, Cheng; Liu, Ying; Xu, Yingjie; Yang, Binyi; Wang, Rongchun; Luo, Hong. Case Report: DNAAF4 Variants Cause Primary Ciliary Dyskinesia and Infertility in Two Han Chinese Families. Frontiers In Genetics. 13( 35903363):934920. 

Cho, Jung Hoon; Li, Zipeng A; Zhu, Lifei; Muegge, Brian D; Roseman, Henry F; Lee, Eun Young; Utterback, Toby; Woodhams, Louis G; Bayly, Philip V; Hughes, Jing W. Islet primary cilia motility controls insulin secretion. Science Advances. 2022;8(38):eabq8486. 

Jiang, Guoliang; Zou, Lijun; Long, Lingzhi; He, Yijun; Lv, Xin; Han, Yuanyuan; Yao, Tingting; Zhang, Yan; Jiang, Mao; Peng, Zhangzhe; Tao, Lijian; Xie, Wei; Meng, Jie. Homozygous mutation in DNAAF4 causes primary ciliary dyskinesia in a Chinese family. Frontiers In Genetics. 13( 36583018):1087818.