Anti DNAL1 pAb (ATL-HPA060974)

Atlas Antibodies

SKU:
ATL-HPA060974-25
  • Immunohistochemical staining of human fallopian tube shows strong ciliary positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dynein axonemal light chain 1
Gene Name: DNAL1
Alternative Gene Name: 1700010H15RiK, C14orf168, CILD16, MGC12435
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042523: 94%, ENSRNOG00000042333: 94%
Entrez Gene ID: 83544
Uniprot ID: Q4LDG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDE
Gene Sequence NFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDE
Gene ID - Mouse ENSMUSG00000042523
Gene ID - Rat ENSRNOG00000042333
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNAL1 pAb (ATL-HPA060974)
Datasheet Anti DNAL1 pAb (ATL-HPA060974) Datasheet (External Link)
Vendor Page Anti DNAL1 pAb (ATL-HPA060974) at Atlas Antibodies

Documents & Links for Anti DNAL1 pAb (ATL-HPA060974)
Datasheet Anti DNAL1 pAb (ATL-HPA060974) Datasheet (External Link)
Vendor Page Anti DNAL1 pAb (ATL-HPA060974)