Anti DNAL1 pAb (ATL-HPA060974)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060974-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: DNAL1
Alternative Gene Name: 1700010H15RiK, C14orf168, CILD16, MGC12435
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042523: 94%, ENSRNOG00000042333: 94%
Entrez Gene ID: 83544
Uniprot ID: Q4LDG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDE |
| Gene Sequence | NFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDE |
| Gene ID - Mouse | ENSMUSG00000042523 |
| Gene ID - Rat | ENSRNOG00000042333 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNAL1 pAb (ATL-HPA060974) | |
| Datasheet | Anti DNAL1 pAb (ATL-HPA060974) Datasheet (External Link) |
| Vendor Page | Anti DNAL1 pAb (ATL-HPA060974) at Atlas Antibodies |
| Documents & Links for Anti DNAL1 pAb (ATL-HPA060974) | |
| Datasheet | Anti DNAL1 pAb (ATL-HPA060974) Datasheet (External Link) |
| Vendor Page | Anti DNAL1 pAb (ATL-HPA060974) |