Anti DNAJC9 pAb (ATL-HPA035216 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA035216-25
  • Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm, plasma membrane & cytosol.
  • Western blot analysis using Anti-DNAJC9 antibody HPA035216 (A) shows similar pattern to independent antibody HPA035215 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 9
Gene Name: DNAJC9
Alternative Gene Name: JDD1, SB73
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021811: 86%, ENSRNOG00000006619: 91%
Entrez Gene ID: 23234
Uniprot ID: Q8WXX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKS
Gene Sequence EPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKS
Gene ID - Mouse ENSMUSG00000021811
Gene ID - Rat ENSRNOG00000006619
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti DNAJC9 pAb (ATL-HPA035216 w/enhanced validation)
Datasheet Anti DNAJC9 pAb (ATL-HPA035216 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DNAJC9 pAb (ATL-HPA035216 w/enhanced validation)