Anti DNAJC8 pAb (ATL-HPA026275)

Atlas Antibodies

SKU:
ATL-HPA026275-25
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm, cytosol & cytokinetic bridge.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 8
Gene Name: DNAJC8
Alternative Gene Name: SPF31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054405: 87%, ENSRNOG00000013255: 87%
Entrez Gene ID: 22826
Uniprot ID: O75937
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGSRGGWAGEMAASGESGTSGGGGSTEEAFMTFYSEVKQIEKRDSVLTSKNQIERLTRPGSSYFNLNPFEVLQIDPEVTDEEIK
Gene Sequence EGSRGGWAGEMAASGESGTSGGGGSTEEAFMTFYSEVKQIEKRDSVLTSKNQIERLTRPGSSYFNLNPFEVLQIDPEVTDEEIK
Gene ID - Mouse ENSMUSG00000054405
Gene ID - Rat ENSRNOG00000013255
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNAJC8 pAb (ATL-HPA026275)
Datasheet Anti DNAJC8 pAb (ATL-HPA026275) Datasheet (External Link)
Vendor Page Anti DNAJC8 pAb (ATL-HPA026275) at Atlas Antibodies

Documents & Links for Anti DNAJC8 pAb (ATL-HPA026275)
Datasheet Anti DNAJC8 pAb (ATL-HPA026275) Datasheet (External Link)
Vendor Page Anti DNAJC8 pAb (ATL-HPA026275)