Anti DNAJC7 pAb (ATL-HPA023015)

Atlas Antibodies

SKU: ATL-HPA023015-100

• 
• 
• 

Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 7
Gene Name: DNAJC7
Alternative Gene Name: TPR2, TTC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014195: 100%, ENSRNOG00000017781: 100%
Entrez Gene ID: 7266
Uniprot ID: Q99615
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVME
• Gene Sequence: ATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVME
• Gene ID - Mouse: ENSMUSG00000014195
• Gene ID - Rat: ENSRNOG00000017781
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.