Anti DNAJC7 pAb (ATL-HPA023015)

Atlas Antibodies

Catalog No.:
ATL-HPA023015-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 7
Gene Name: DNAJC7
Alternative Gene Name: TPR2, TTC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014195: 100%, ENSRNOG00000017781: 100%
Entrez Gene ID: 7266
Uniprot ID: Q99615
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVME
Gene Sequence ATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVME
Gene ID - Mouse ENSMUSG00000014195
Gene ID - Rat ENSRNOG00000017781
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAJC7 pAb (ATL-HPA023015)
Datasheet Anti DNAJC7 pAb (ATL-HPA023015) Datasheet (External Link)
Vendor Page Anti DNAJC7 pAb (ATL-HPA023015) at Atlas Antibodies

Documents & Links for Anti DNAJC7 pAb (ATL-HPA023015)
Datasheet Anti DNAJC7 pAb (ATL-HPA023015) Datasheet (External Link)
Vendor Page Anti DNAJC7 pAb (ATL-HPA023015)