Anti DNAJC6 pAb (ATL-HPA031182 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA031182-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 6
Gene Name: DNAJC6
Alternative Gene Name: KIAA0473
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028528: 81%, ENSRNOG00000052887: 84%
Entrez Gene ID: 9829
Uniprot ID: O75061
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTP
Gene Sequence NGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTP
Gene ID - Mouse ENSMUSG00000028528
Gene ID - Rat ENSRNOG00000052887
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAJC6 pAb (ATL-HPA031182 w/enhanced validation)
Datasheet Anti DNAJC6 pAb (ATL-HPA031182 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DNAJC6 pAb (ATL-HPA031182 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DNAJC6 pAb (ATL-HPA031182 w/enhanced validation)
Datasheet Anti DNAJC6 pAb (ATL-HPA031182 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DNAJC6 pAb (ATL-HPA031182 w/enhanced validation)
Citations for Anti DNAJC6 pAb (ATL-HPA031182 w/enhanced validation) – 2 Found
Meisgen, Sabrina; Hedlund, Malin; Ambrosi, Aurelie; Folkersen, Lasse; Ottosson, Vijole; Forsberg, David; Thorlacius, Gudny Ella; Biavati, Luca; Strandberg, Linn; Mofors, Johannes; Ramskold, Daniel; Ruhrmann, Sabrina; Meneghel, Lauro; Nyberg, William; Espinosa, Alexander; Hamilton, Robert Murray; Franco-Cereceda, Anders; Hamsten, Anders; Olsson, Tomas; Greene, Lois; Eriksson, Per; Gemzell-Danielsson, Kristina; Salomonsson, Stina; Kuchroo, Vijay K; Herlenius, Eric; Kockum, Ingrid; Sonesson, Sven-Erik; Wahren-Herlenius, Marie. Auxilin is a novel susceptibility gene for congenital heart block which directly impacts fetal heart function. Annals Of The Rheumatic Diseases. 2022;81(8):1151-1161.  PubMed
Ng, Xin Yi; Wu, Yumei; Lin, Youneng; Yaqoob, Sidra Mohamed; Greene, Lois E; De Camilli, Pietro; Cao, Mian. Mutations in Parkinsonism-linked endocytic proteins synaptojanin1 and auxilin have synergistic effects on dopaminergic axonal pathology. Npj Parkinson's Disease. 2023;9(1):26.  PubMed