Anti DNAJC5G pAb (ATL-HPA041445 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041445-25

• 
• 

Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 5 gamma
Gene Name: DNAJC5G
Alternative Gene Name: CSP-gamma, FLJ40417
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053856: 78%, ENSRNOG00000026578: 78%
Entrez Gene ID: 285126
Uniprot ID: Q8N7S2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRY
• Gene Sequence: NAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRY
• Gene ID - Mouse: ENSMUSG00000053856
• Gene ID - Rat: ENSRNOG00000026578
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.