Anti DNAJC5B pAb (ATL-HPA077389)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077389-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DNAJC5B
Alternative Gene Name: CSP-beta, MGC26226
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027606: 90%, ENSRNOG00000012851: 88%
Entrez Gene ID: 85479
Uniprot ID: Q9UF47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYR |
| Gene Sequence | MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYR |
| Gene ID - Mouse | ENSMUSG00000027606 |
| Gene ID - Rat | ENSRNOG00000012851 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNAJC5B pAb (ATL-HPA077389) | |
| Datasheet | Anti DNAJC5B pAb (ATL-HPA077389) Datasheet (External Link) |
| Vendor Page | Anti DNAJC5B pAb (ATL-HPA077389) at Atlas Antibodies |
| Documents & Links for Anti DNAJC5B pAb (ATL-HPA077389) | |
| Datasheet | Anti DNAJC5B pAb (ATL-HPA077389) Datasheet (External Link) |
| Vendor Page | Anti DNAJC5B pAb (ATL-HPA077389) |