Anti DNAJC5B pAb (ATL-HPA077389)

Atlas Antibodies

Catalog No.: ATL-HPA077389-25

Protein Description: DnaJ heat shock protein family (Hsp40) member C5 beta
Gene Name: DNAJC5B
Alternative Gene Name: CSP-beta, MGC26226
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027606: 90%, ENSRNOG00000012851: 88%
Entrez Gene ID: 85479
Uniprot ID: Q9UF47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYR
• Gene Sequence: MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYR
• Gene ID - Mouse: ENSMUSG00000027606
• Gene ID - Rat: ENSRNOG00000012851
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.