Anti DNAJC5 pAb (ATL-HPA013154)

Atlas Antibodies

SKU: ATL-HPA013154-25

• 

Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 5
Gene Name: DNAJC5
Alternative Gene Name: CLN4, DNAJC5A, FLJ00118, FLJ13070
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000826: 100%, ENSRNOG00000015202: 100%
Entrez Gene ID: 80331
Uniprot ID: Q9H3Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDAT
• Gene Sequence: MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDAT
• Gene ID - Mouse: ENSMUSG00000000826
• Gene ID - Rat: ENSRNOG00000015202
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.