Anti DNAJC3 pAb (ATL-HPA039336)

Atlas Antibodies

SKU:
ATL-HPA039336-25
  • Immunohistochemical staining of human thyroid gland shows cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 3
Gene Name: DNAJC3
Alternative Gene Name: HP58, P58, P58IPK, PRKRI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022136: 99%, ENSRNOG00000010352: 95%
Entrez Gene ID: 5611
Uniprot ID: Q13217
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSIAEYTVR
Gene Sequence YKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSIAEYTVR
Gene ID - Mouse ENSMUSG00000022136
Gene ID - Rat ENSRNOG00000010352
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNAJC3 pAb (ATL-HPA039336)
Datasheet Anti DNAJC3 pAb (ATL-HPA039336) Datasheet (External Link)
Vendor Page Anti DNAJC3 pAb (ATL-HPA039336) at Atlas Antibodies

Documents & Links for Anti DNAJC3 pAb (ATL-HPA039336)
Datasheet Anti DNAJC3 pAb (ATL-HPA039336) Datasheet (External Link)
Vendor Page Anti DNAJC3 pAb (ATL-HPA039336)