Anti DNAJC25 pAb (ATL-HPA019122)

Atlas Antibodies

SKU:
ATL-HPA019122-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in liver.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C , member 25
Gene Name: DNAJC25
Alternative Gene Name: bA16L21.2.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070972: 98%, ENSRNOG00000015340: 98%
Entrez Gene ID: 548645
Uniprot ID: Q9H1X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NIKGKEYGEEERLYIIRKSMKMSKSQFDSLEDHQKETFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD
Gene Sequence NIKGKEYGEEERLYIIRKSMKMSKSQFDSLEDHQKETFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD
Gene ID - Mouse ENSMUSG00000070972
Gene ID - Rat ENSRNOG00000015340
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNAJC25 pAb (ATL-HPA019122)
Datasheet Anti DNAJC25 pAb (ATL-HPA019122) Datasheet (External Link)
Vendor Page Anti DNAJC25 pAb (ATL-HPA019122) at Atlas Antibodies

Documents & Links for Anti DNAJC25 pAb (ATL-HPA019122)
Datasheet Anti DNAJC25 pAb (ATL-HPA019122) Datasheet (External Link)
Vendor Page Anti DNAJC25 pAb (ATL-HPA019122)