Anti DNAJC24 pAb (ATL-HPA020025)

Atlas Antibodies

SKU: ATL-HPA020025-25

• 
• 
• 

Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 24
Gene Name: DNAJC24
Alternative Gene Name: DPH4, JJJ3, ZCSL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027166: 88%, ENSRNOG00000004842: 88%
Entrez Gene ID: 120526
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWK
• Gene Sequence: MAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWK
• Gene ID - Mouse: ENSMUSG00000027166
• Gene ID - Rat: ENSRNOG00000004842
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.