Anti DNAJC22 pAb (ATL-HPA039953)

Atlas Antibodies

SKU:
ATL-HPA039953-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 22
Gene Name: DNAJC22
Alternative Gene Name: FLJ13236, wus
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038009: 84%, ENSRNOG00000053498: 85%
Entrez Gene ID: 79962
Uniprot ID: Q8N4W6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKP
Gene Sequence GETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKP
Gene ID - Mouse ENSMUSG00000038009
Gene ID - Rat ENSRNOG00000053498
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNAJC22 pAb (ATL-HPA039953)
Datasheet Anti DNAJC22 pAb (ATL-HPA039953) Datasheet (External Link)
Vendor Page Anti DNAJC22 pAb (ATL-HPA039953) at Atlas Antibodies

Documents & Links for Anti DNAJC22 pAb (ATL-HPA039953)
Datasheet Anti DNAJC22 pAb (ATL-HPA039953) Datasheet (External Link)
Vendor Page Anti DNAJC22 pAb (ATL-HPA039953)