Anti DNAJC2 pAb (ATL-HPA020454)

Atlas Antibodies

SKU:
ATL-HPA020454-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 2
Gene Name: DNAJC2
Alternative Gene Name: MPHOSPH11, MPP11, ZRF1, ZUO1, zuotin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029014: 92%, ENSRNOG00000012392: 90%
Entrez Gene ID: 27000
Uniprot ID: Q99543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen EEINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDV
Gene Sequence EEINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDV
Gene ID - Mouse ENSMUSG00000029014
Gene ID - Rat ENSRNOG00000012392
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNAJC2 pAb (ATL-HPA020454)
Datasheet Anti DNAJC2 pAb (ATL-HPA020454) Datasheet (External Link)
Vendor Page Anti DNAJC2 pAb (ATL-HPA020454) at Atlas Antibodies

Documents & Links for Anti DNAJC2 pAb (ATL-HPA020454)
Datasheet Anti DNAJC2 pAb (ATL-HPA020454) Datasheet (External Link)
Vendor Page Anti DNAJC2 pAb (ATL-HPA020454)