Anti DNAJC19 pAb (ATL-HPA037782)
Atlas Antibodies
- SKU:
- ATL-HPA037782-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DNAJC19
Alternative Gene Name: Pam18, Tim14, TIMM14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027679: 94%, ENSRNOG00000049819: 97%
Entrez Gene ID: 131118
Uniprot ID: Q96DA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPK |
Gene Sequence | LQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPK |
Gene ID - Mouse | ENSMUSG00000027679 |
Gene ID - Rat | ENSRNOG00000049819 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DNAJC19 pAb (ATL-HPA037782) | |
Datasheet | Anti DNAJC19 pAb (ATL-HPA037782) Datasheet (External Link) |
Vendor Page | Anti DNAJC19 pAb (ATL-HPA037782) at Atlas Antibodies |
Documents & Links for Anti DNAJC19 pAb (ATL-HPA037782) | |
Datasheet | Anti DNAJC19 pAb (ATL-HPA037782) Datasheet (External Link) |
Vendor Page | Anti DNAJC19 pAb (ATL-HPA037782) |