Anti DNAJC19 pAb (ATL-HPA037782)

Atlas Antibodies

SKU: ATL-HPA037782-25

• 

Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 19
Gene Name: DNAJC19
Alternative Gene Name: Pam18, Tim14, TIMM14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027679: 94%, ENSRNOG00000049819: 97%
Entrez Gene ID: 131118
Uniprot ID: Q96DA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPK
• Gene Sequence: LQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPK
• Gene ID - Mouse: ENSMUSG00000027679
• Gene ID - Rat: ENSRNOG00000049819
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.