Anti DNAJC19 pAb (ATL-HPA037782)

Atlas Antibodies

Catalog No.:
ATL-HPA037782-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 19
Gene Name: DNAJC19
Alternative Gene Name: Pam18, Tim14, TIMM14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027679: 94%, ENSRNOG00000049819: 97%
Entrez Gene ID: 131118
Uniprot ID: Q96DA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPK
Gene Sequence LQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPK
Gene ID - Mouse ENSMUSG00000027679
Gene ID - Rat ENSRNOG00000049819
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAJC19 pAb (ATL-HPA037782)
Datasheet Anti DNAJC19 pAb (ATL-HPA037782) Datasheet (External Link)
Vendor Page Anti DNAJC19 pAb (ATL-HPA037782) at Atlas Antibodies

Documents & Links for Anti DNAJC19 pAb (ATL-HPA037782)
Datasheet Anti DNAJC19 pAb (ATL-HPA037782) Datasheet (External Link)
Vendor Page Anti DNAJC19 pAb (ATL-HPA037782)