Anti DNAJC18 pAb (ATL-HPA060154)

Atlas Antibodies

Catalog No.:
ATL-HPA060154-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 18
Gene Name: DNAJC18
Alternative Gene Name: MGC29463
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024350: 83%, ENSRNOG00000019995: 81%
Entrez Gene ID: 202052
Uniprot ID: Q9H819
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPEELFNVFFGGHFPTGNIHMFSNVTDDTYYYRRRHRHERTQTQKEEEEEKPQTTYSA
Gene Sequence TPEELFNVFFGGHFPTGNIHMFSNVTDDTYYYRRRHRHERTQTQKEEEEEKPQTTYSA
Gene ID - Mouse ENSMUSG00000024350
Gene ID - Rat ENSRNOG00000019995
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAJC18 pAb (ATL-HPA060154)
Datasheet Anti DNAJC18 pAb (ATL-HPA060154) Datasheet (External Link)
Vendor Page Anti DNAJC18 pAb (ATL-HPA060154) at Atlas Antibodies

Documents & Links for Anti DNAJC18 pAb (ATL-HPA060154)
Datasheet Anti DNAJC18 pAb (ATL-HPA060154) Datasheet (External Link)
Vendor Page Anti DNAJC18 pAb (ATL-HPA060154)