Anti DNAJC18 pAb (ATL-HPA036538 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA036538-25
  • Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & cell junctions.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DNAJC18 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407362).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 18
Gene Name: DNAJC18
Alternative Gene Name: MGC29463
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024350: 97%, ENSRNOG00000019995: 97%
Entrez Gene ID: 202052
Uniprot ID: Q9H819
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIEKDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSKL
Gene Sequence STLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIEKDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSKL
Gene ID - Mouse ENSMUSG00000024350
Gene ID - Rat ENSRNOG00000019995
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti DNAJC18 pAb (ATL-HPA036538 w/enhanced validation)
Datasheet Anti DNAJC18 pAb (ATL-HPA036538 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DNAJC18 pAb (ATL-HPA036538 w/enhanced validation)