Anti DNAJC17 pAb (ATL-HPA041187 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041187-25

• 
• 

Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 17
Gene Name: DNAJC17
Alternative Gene Name: FLJ10634
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034278: 94%, ENSRNOG00000012368: 94%
Entrez Gene ID: 55192
Uniprot ID: Q9NVM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NPRAAELFHQLSQALEVLTDAAARAAYDKVRKAKKQAAERTQKLDEKRKKVKLDLEARERQAQAQES
• Gene Sequence: NPRAAELFHQLSQALEVLTDAAARAAYDKVRKAKKQAAERTQKLDEKRKKVKLDLEARERQAQAQES
• Gene ID - Mouse: ENSMUSG00000034278
• Gene ID - Rat: ENSRNOG00000012368
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.