Anti DNAJC17 pAb (ATL-HPA040914 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA040914-25
  • Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DNAJC17 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 17
Gene Name: DNAJC17
Alternative Gene Name: FLJ10634
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034278: 82%, ENSRNOG00000012368: 84%
Entrez Gene ID: 55192
Uniprot ID: Q9NVM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen AVVEFATVKAAELAVQNEVGLVDNPLKISWLEGQPQDAVGRSHSGLSKGSVLSERDYESLVMMRMRQAAERQQLIARMQQEDQ
Gene Sequence AVVEFATVKAAELAVQNEVGLVDNPLKISWLEGQPQDAVGRSHSGLSKGSVLSERDYESLVMMRMRQAAERQQLIARMQQEDQ
Gene ID - Mouse ENSMUSG00000034278
Gene ID - Rat ENSRNOG00000012368
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti DNAJC17 pAb (ATL-HPA040914 w/enhanced validation)
Datasheet Anti DNAJC17 pAb (ATL-HPA040914 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DNAJC17 pAb (ATL-HPA040914 w/enhanced validation)