Anti DNAJC14 pAb (ATL-HPA017653)

Atlas Antibodies

SKU:
ATL-HPA017653-25
  • Immunohistochemical staining of human stomach shows cytoplasmic positivity in glandular cells. Parietal cells show strong staining.
  • Western blot analysis in human cell line EFO-21.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 14
Gene Name: DNAJC14
Alternative Gene Name: DNAJ, DRIP78, FLJ32792, HDJ3, LIP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025354: 93%, ENSRNOG00000006844: 95%
Entrez Gene ID: 85406
Uniprot ID: Q6Y2X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen WGWLELPWVKQNINRQGNAPVASGRYCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHPRAEEAFKVLRAAWDIVSNAEKRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSRCQG
Gene Sequence WGWLELPWVKQNINRQGNAPVASGRYCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHPRAEEAFKVLRAAWDIVSNAEKRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSRCQG
Gene ID - Mouse ENSMUSG00000025354
Gene ID - Rat ENSRNOG00000006844
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNAJC14 pAb (ATL-HPA017653)
Datasheet Anti DNAJC14 pAb (ATL-HPA017653) Datasheet (External Link)
Vendor Page Anti DNAJC14 pAb (ATL-HPA017653) at Atlas Antibodies

Documents & Links for Anti DNAJC14 pAb (ATL-HPA017653)
Datasheet Anti DNAJC14 pAb (ATL-HPA017653) Datasheet (External Link)
Vendor Page Anti DNAJC14 pAb (ATL-HPA017653)



Citations for Anti DNAJC14 pAb (ATL-HPA017653) – 3 Found
Bozzacco, Leonia; Yi, Zhigang; Andreo, Ursula; Conklin, Claire R; Li, Melody M H; Rice, Charles M; MacDonald, Margaret R. Chaperone-Assisted Protein Folding Is Critical for Yellow Fever Virus NS3/4A Cleavage and Replication. Journal Of Virology. 2016;90(6):3212-28.  PubMed
Yi, Zhigang; Sperzel, Lindsey; Nürnberger, Cindy; Bredenbeek, Peter J; Lubick, Kirk J; Best, Sonja M; Stoyanov, Cristina T; Law, Lok Man J; Yuan, Zhenghong; Rice, Charles M; MacDonald, Margaret R. Identification and characterization of the host protein DNAJC14 as a broadly active flavivirus replication modulator. Plos Pathogens. 2011;7(1):e1001255.  PubMed
Yi, Zhigang; Yuan, Zhenghong; Rice, Charles M; MacDonald, Margaret R. Flavivirus replication complex assembly revealed by DNAJC14 functional mapping. Journal Of Virology. 2012;86(21):11815-32.  PubMed