Anti DNAJC13 pAb (ATL-HPA036924)

Atlas Antibodies

SKU:
ATL-HPA036924-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 13
Gene Name: DNAJC13
Alternative Gene Name: KIAA0678, RME8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032560: 97%, ENSRNOG00000011491: 97%
Entrez Gene ID: 23317
Uniprot ID: O75165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVRAQTAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNPEAAVHIFEGTHENPELIWNDNSRDKVSTTVREMM
Gene Sequence QVRAQTAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNPEAAVHIFEGTHENPELIWNDNSRDKVSTTVREMM
Gene ID - Mouse ENSMUSG00000032560
Gene ID - Rat ENSRNOG00000011491
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNAJC13 pAb (ATL-HPA036924)
Datasheet Anti DNAJC13 pAb (ATL-HPA036924) Datasheet (External Link)
Vendor Page Anti DNAJC13 pAb (ATL-HPA036924) at Atlas Antibodies

Documents & Links for Anti DNAJC13 pAb (ATL-HPA036924)
Datasheet Anti DNAJC13 pAb (ATL-HPA036924) Datasheet (External Link)
Vendor Page Anti DNAJC13 pAb (ATL-HPA036924)