Anti DNAJC12 pAb (ATL-HPA036289)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036289-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DNAJC12
Alternative Gene Name: JDP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036764: 90%, ENSRNOG00000051960: 90%
Entrez Gene ID: 56521
Uniprot ID: Q9UKB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGK |
Gene Sequence | ILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGK |
Gene ID - Mouse | ENSMUSG00000036764 |
Gene ID - Rat | ENSRNOG00000051960 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DNAJC12 pAb (ATL-HPA036289) | |
Datasheet | Anti DNAJC12 pAb (ATL-HPA036289) Datasheet (External Link) |
Vendor Page | Anti DNAJC12 pAb (ATL-HPA036289) at Atlas Antibodies |
Documents & Links for Anti DNAJC12 pAb (ATL-HPA036289) | |
Datasheet | Anti DNAJC12 pAb (ATL-HPA036289) Datasheet (External Link) |
Vendor Page | Anti DNAJC12 pAb (ATL-HPA036289) |