Anti DNAJC12 pAb (ATL-HPA036289)

Atlas Antibodies

Catalog No.: ATL-HPA036289-25

Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 12
Gene Name: DNAJC12
Alternative Gene Name: JDP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036764: 90%, ENSRNOG00000051960: 90%
Entrez Gene ID: 56521
Uniprot ID: Q9UKB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGK
• Gene Sequence: ILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGK
• Gene ID - Mouse: ENSMUSG00000036764
• Gene ID - Rat: ENSRNOG00000051960
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.