Anti DNAJC12 pAb (ATL-HPA036289)

Atlas Antibodies

Catalog No.:
ATL-HPA036289-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 12
Gene Name: DNAJC12
Alternative Gene Name: JDP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036764: 90%, ENSRNOG00000051960: 90%
Entrez Gene ID: 56521
Uniprot ID: Q9UKB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGK
Gene Sequence ILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGK
Gene ID - Mouse ENSMUSG00000036764
Gene ID - Rat ENSRNOG00000051960
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAJC12 pAb (ATL-HPA036289)
Datasheet Anti DNAJC12 pAb (ATL-HPA036289) Datasheet (External Link)
Vendor Page Anti DNAJC12 pAb (ATL-HPA036289) at Atlas Antibodies

Documents & Links for Anti DNAJC12 pAb (ATL-HPA036289)
Datasheet Anti DNAJC12 pAb (ATL-HPA036289) Datasheet (External Link)
Vendor Page Anti DNAJC12 pAb (ATL-HPA036289)