Anti DNAJC12 pAb (ATL-HPA036289)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036289-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: DNAJC12
Alternative Gene Name: JDP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036764: 90%, ENSRNOG00000051960: 90%
Entrez Gene ID: 56521
Uniprot ID: Q9UKB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGK |
| Gene Sequence | ILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGK |
| Gene ID - Mouse | ENSMUSG00000036764 |
| Gene ID - Rat | ENSRNOG00000051960 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNAJC12 pAb (ATL-HPA036289) | |
| Datasheet | Anti DNAJC12 pAb (ATL-HPA036289) Datasheet (External Link) |
| Vendor Page | Anti DNAJC12 pAb (ATL-HPA036289) at Atlas Antibodies |
| Documents & Links for Anti DNAJC12 pAb (ATL-HPA036289) | |
| Datasheet | Anti DNAJC12 pAb (ATL-HPA036289) Datasheet (External Link) |
| Vendor Page | Anti DNAJC12 pAb (ATL-HPA036289) |