Anti DNAJB7 pAb (ATL-HPA000534)

Atlas Antibodies

Catalog No.: ATL-HPA000534-25

Protein Description: DnaJ (Hsp40) homolog, subfamily B, member 7
Gene Name: DNAJB7
Alternative Gene Name: HSC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047108: 78%, ENSRNOG00000019187: 80%
Entrez Gene ID: 150353
Uniprot ID: Q7Z6W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDKYGTEGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHFFEDSLEDLLNRPGSSYGNRNRDAGYFFSTASEYP
• Gene Sequence: VLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDKYGTEGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHFFEDSLEDLLNRPGSSYGNRNRDAGYFFSTASEYP
• Gene ID - Mouse: ENSMUSG00000047108
• Gene ID - Rat: ENSRNOG00000019187
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.