Anti DNAJB7 pAb (ATL-HPA000534)
Atlas Antibodies
- SKU:
- ATL-HPA000534-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DNAJB7
Alternative Gene Name: HSC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047108: 78%, ENSRNOG00000019187: 80%
Entrez Gene ID: 150353
Uniprot ID: Q7Z6W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDKYGTEGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHFFEDSLEDLLNRPGSSYGNRNRDAGYFFSTASEYP |
Gene Sequence | VLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDKYGTEGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHFFEDSLEDLLNRPGSSYGNRNRDAGYFFSTASEYP |
Gene ID - Mouse | ENSMUSG00000047108 |
Gene ID - Rat | ENSRNOG00000019187 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DNAJB7 pAb (ATL-HPA000534) | |
Datasheet | Anti DNAJB7 pAb (ATL-HPA000534) Datasheet (External Link) |
Vendor Page | Anti DNAJB7 pAb (ATL-HPA000534) at Atlas Antibodies |
Documents & Links for Anti DNAJB7 pAb (ATL-HPA000534) | |
Datasheet | Anti DNAJB7 pAb (ATL-HPA000534) Datasheet (External Link) |
Vendor Page | Anti DNAJB7 pAb (ATL-HPA000534) |