Anti DNAJB7 pAb (ATL-HPA000534)

Atlas Antibodies

Catalog No.:
ATL-HPA000534-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily B, member 7
Gene Name: DNAJB7
Alternative Gene Name: HSC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047108: 78%, ENSRNOG00000019187: 80%
Entrez Gene ID: 150353
Uniprot ID: Q7Z6W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDKYGTEGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHFFEDSLEDLLNRPGSSYGNRNRDAGYFFSTASEYP
Gene Sequence VLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDKYGTEGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHFFEDSLEDLLNRPGSSYGNRNRDAGYFFSTASEYP
Gene ID - Mouse ENSMUSG00000047108
Gene ID - Rat ENSRNOG00000019187
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAJB7 pAb (ATL-HPA000534)
Datasheet Anti DNAJB7 pAb (ATL-HPA000534) Datasheet (External Link)
Vendor Page Anti DNAJB7 pAb (ATL-HPA000534) at Atlas Antibodies

Documents & Links for Anti DNAJB7 pAb (ATL-HPA000534)
Datasheet Anti DNAJB7 pAb (ATL-HPA000534) Datasheet (External Link)
Vendor Page Anti DNAJB7 pAb (ATL-HPA000534)