Anti DNAJB6 pAb (ATL-HPA058593)

Atlas Antibodies

Catalog No.:
ATL-HPA058593-100
Immunohistochemical staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts, Leydig cells.
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily B, member 6
Gene Name: DNAJB6
Alternative Gene Name: LGMD1D, MRJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022211: 33%, ENSRNOG00000010353: 37%
Entrez Gene ID: 10049
Uniprot ID: O75190
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VADDDALAEERMRRGQNALPAQPAGLRPPKPPRPASLLRHAPHCLSEEEGEQDRPRAPGPWDPLASAAGLK
Gene Sequence VADDDALAEERMRRGQNALPAQPAGLRPPKPPRPASLLRHAPHCLSEEEGEQDRPRAPGPWDPLASAAGLK
Gene ID - Mouse ENSMUSG00000022211
Gene ID - Rat ENSRNOG00000010353
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAJB6 pAb (ATL-HPA058593)
Datasheet Anti DNAJB6 pAb (ATL-HPA058593) Datasheet (External Link)
Vendor Page Anti DNAJB6 pAb (ATL-HPA058593) at Atlas Antibodies

Documents & Links for Anti DNAJB6 pAb (ATL-HPA058593)
Datasheet Anti DNAJB6 pAb (ATL-HPA058593) Datasheet (External Link)
Vendor Page Anti DNAJB6 pAb (ATL-HPA058593)
!