Anti DNAJB4 pAb (ATL-HPA028383)

Atlas Antibodies

Catalog No.:
ATL-HPA028383-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily B, member 4
Gene Name: DNAJB4
Alternative Gene Name: HLJ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028035: 98%, ENSRNOG00000013011: 97%
Entrez Gene ID: 11080
Uniprot ID: Q9UDY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIH
Gene Sequence SNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIH
Gene ID - Mouse ENSMUSG00000028035
Gene ID - Rat ENSRNOG00000013011
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAJB4 pAb (ATL-HPA028383)
Datasheet Anti DNAJB4 pAb (ATL-HPA028383) Datasheet (External Link)
Vendor Page Anti DNAJB4 pAb (ATL-HPA028383) at Atlas Antibodies

Documents & Links for Anti DNAJB4 pAb (ATL-HPA028383)
Datasheet Anti DNAJB4 pAb (ATL-HPA028383) Datasheet (External Link)
Vendor Page Anti DNAJB4 pAb (ATL-HPA028383)