Anti DNAJB14 pAb (ATL-HPA036016)

Atlas Antibodies

SKU: ATL-HPA036016-25

• 
• 

Protein Description: DnaJ (Hsp40) homolog, subfamily B, member 14
Gene Name: DNAJB14
Alternative Gene Name: FLJ14281
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074212: 87%, ENSRNOG00000060107: 85%
Entrez Gene ID: 79982
Uniprot ID: Q8TBM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKPSGSGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKDAGDED
• Gene Sequence: RKPSGSGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKDAGDED
• Gene ID - Mouse: ENSMUSG00000074212
• Gene ID - Rat: ENSRNOG00000060107
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.