Anti DNAJB14 pAb (ATL-HPA036016)

Atlas Antibodies

Catalog No.:
ATL-HPA036016-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily B, member 14
Gene Name: DNAJB14
Alternative Gene Name: FLJ14281
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074212: 87%, ENSRNOG00000060107: 85%
Entrez Gene ID: 79982
Uniprot ID: Q8TBM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen RKPSGSGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKDAGDED
Gene Sequence RKPSGSGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKDAGDED
Gene ID - Mouse ENSMUSG00000074212
Gene ID - Rat ENSRNOG00000060107
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAJB14 pAb (ATL-HPA036016)
Datasheet Anti DNAJB14 pAb (ATL-HPA036016) Datasheet (External Link)
Vendor Page Anti DNAJB14 pAb (ATL-HPA036016) at Atlas Antibodies

Documents & Links for Anti DNAJB14 pAb (ATL-HPA036016)
Datasheet Anti DNAJB14 pAb (ATL-HPA036016) Datasheet (External Link)
Vendor Page Anti DNAJB14 pAb (ATL-HPA036016)