Anti DNAJB13 pAb (ATL-HPA061330)

Atlas Antibodies

Catalog No.:
ATL-HPA061330-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DnaJ heat shock protein family (Hsp40) member B13
Gene Name: DNAJB13
Alternative Gene Name: RSPH16A, TSARG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030708: 84%, ENSRNOG00000017975: 86%
Entrez Gene ID: 374407
Uniprot ID: P59910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE
Gene Sequence WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE
Gene ID - Mouse ENSMUSG00000030708
Gene ID - Rat ENSRNOG00000017975
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAJB13 pAb (ATL-HPA061330)
Datasheet Anti DNAJB13 pAb (ATL-HPA061330) Datasheet (External Link)
Vendor Page Anti DNAJB13 pAb (ATL-HPA061330) at Atlas Antibodies

Documents & Links for Anti DNAJB13 pAb (ATL-HPA061330)
Datasheet Anti DNAJB13 pAb (ATL-HPA061330) Datasheet (External Link)
Vendor Page Anti DNAJB13 pAb (ATL-HPA061330)