Anti DNAJB13 pAb (ATL-HPA061330)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061330-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DNAJB13
Alternative Gene Name: RSPH16A, TSARG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030708: 84%, ENSRNOG00000017975: 86%
Entrez Gene ID: 374407
Uniprot ID: P59910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE |
Gene Sequence | WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE |
Gene ID - Mouse | ENSMUSG00000030708 |
Gene ID - Rat | ENSRNOG00000017975 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DNAJB13 pAb (ATL-HPA061330) | |
Datasheet | Anti DNAJB13 pAb (ATL-HPA061330) Datasheet (External Link) |
Vendor Page | Anti DNAJB13 pAb (ATL-HPA061330) at Atlas Antibodies |
Documents & Links for Anti DNAJB13 pAb (ATL-HPA061330) | |
Datasheet | Anti DNAJB13 pAb (ATL-HPA061330) Datasheet (External Link) |
Vendor Page | Anti DNAJB13 pAb (ATL-HPA061330) |