Anti DNAJB12 pAb (ATL-HPA072702)

Atlas Antibodies

Catalog No.:
ATL-HPA072702-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DnaJ heat shock protein family (Hsp40) member B12
Gene Name: DNAJB12
Alternative Gene Name: DJ10, FLJ20027
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020109: 93%, ENSRNOG00000030408: 93%
Entrez Gene ID: 54788
Uniprot ID: Q9NXW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCW
Gene Sequence PPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCW
Gene ID - Mouse ENSMUSG00000020109
Gene ID - Rat ENSRNOG00000030408
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAJB12 pAb (ATL-HPA072702)
Datasheet Anti DNAJB12 pAb (ATL-HPA072702) Datasheet (External Link)
Vendor Page Anti DNAJB12 pAb (ATL-HPA072702) at Atlas Antibodies

Documents & Links for Anti DNAJB12 pAb (ATL-HPA072702)
Datasheet Anti DNAJB12 pAb (ATL-HPA072702) Datasheet (External Link)
Vendor Page Anti DNAJB12 pAb (ATL-HPA072702)