Anti DNAJB12 pAb (ATL-HPA072702)

Atlas Antibodies

Catalog No.: ATL-HPA072702-25

Protein Description: DnaJ heat shock protein family (Hsp40) member B12
Gene Name: DNAJB12
Alternative Gene Name: DJ10, FLJ20027
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020109: 93%, ENSRNOG00000030408: 93%
Entrez Gene ID: 54788
Uniprot ID: Q9NXW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCW
• Gene Sequence: PPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCW
• Gene ID - Mouse: ENSMUSG00000020109
• Gene ID - Rat: ENSRNOG00000030408
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.