Anti DNAJB1 pAb (ATL-HPA063247)

Atlas Antibodies

Catalog No.:
ATL-HPA063247-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily B, member 1
Gene Name: DNAJB1
Alternative Gene Name: Hsp40, HSPF1, RSPH16B, Sis1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005483: 92%, ENSRNOG00000021824: 93%
Entrez Gene ID: 3337
Uniprot ID: P25685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDL
Gene Sequence DPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDL
Gene ID - Mouse ENSMUSG00000005483
Gene ID - Rat ENSRNOG00000021824
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAJB1 pAb (ATL-HPA063247)
Datasheet Anti DNAJB1 pAb (ATL-HPA063247) Datasheet (External Link)
Vendor Page Anti DNAJB1 pAb (ATL-HPA063247) at Atlas Antibodies

Documents & Links for Anti DNAJB1 pAb (ATL-HPA063247)
Datasheet Anti DNAJB1 pAb (ATL-HPA063247) Datasheet (External Link)
Vendor Page Anti DNAJB1 pAb (ATL-HPA063247)