Anti DNAJA3 pAb (ATL-HPA044229)

Atlas Antibodies

SKU: ATL-HPA044229-25

• 
• 

Protein Description: DnaJ (Hsp40) homolog, subfamily A, member 3
Gene Name: DNAJA3
Alternative Gene Name: hTid-1, TID1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004069: 89%, ENSRNOG00000003855: 89%
Entrez Gene ID: 9093
Uniprot ID: Q96EY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQQSLILSYAEDETDVEGTVNGVTLTSS
• Gene Sequence: IAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQQSLILSYAEDETDVEGTVNGVTLTSS
• Gene ID - Mouse: ENSMUSG00000004069
• Gene ID - Rat: ENSRNOG00000003855
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.