Anti DNAJA3 pAb (ATL-HPA044229)

Atlas Antibodies

SKU:
ATL-HPA044229-25
  • Immunohistochemical staining of human cerebral cortex shows strong, granular cytoplasmic positivity in neuronal cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily A, member 3
Gene Name: DNAJA3
Alternative Gene Name: hTid-1, TID1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004069: 89%, ENSRNOG00000003855: 89%
Entrez Gene ID: 9093
Uniprot ID: Q96EY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQQSLILSYAEDETDVEGTVNGVTLTSS
Gene Sequence IAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQQSLILSYAEDETDVEGTVNGVTLTSS
Gene ID - Mouse ENSMUSG00000004069
Gene ID - Rat ENSRNOG00000003855
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNAJA3 pAb (ATL-HPA044229)
Datasheet Anti DNAJA3 pAb (ATL-HPA044229) Datasheet (External Link)
Vendor Page Anti DNAJA3 pAb (ATL-HPA044229) at Atlas Antibodies

Documents & Links for Anti DNAJA3 pAb (ATL-HPA044229)
Datasheet Anti DNAJA3 pAb (ATL-HPA044229) Datasheet (External Link)
Vendor Page Anti DNAJA3 pAb (ATL-HPA044229)