Anti DNAI1 pAb (ATL-HPA021649 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021649-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: DNAI1
Alternative Gene Name: CILD1, DIC1, PCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061322: 86%, ENSRNOG00000013734: 80%
Entrez Gene ID: 27019
Uniprot ID: Q9UI46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | APHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQV |
| Gene Sequence | APHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQV |
| Gene ID - Mouse | ENSMUSG00000061322 |
| Gene ID - Rat | ENSRNOG00000013734 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNAI1 pAb (ATL-HPA021649 w/enhanced validation) | |
| Datasheet | Anti DNAI1 pAb (ATL-HPA021649 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNAI1 pAb (ATL-HPA021649 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DNAI1 pAb (ATL-HPA021649 w/enhanced validation) | |
| Datasheet | Anti DNAI1 pAb (ATL-HPA021649 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNAI1 pAb (ATL-HPA021649 w/enhanced validation) |
| Citations for Anti DNAI1 pAb (ATL-HPA021649 w/enhanced validation) – 11 Found |
| Zhang, Haijun; Yang, Jing; Walters, Matthew S; Staudt, Michelle R; Strulovici-Barel, Yael; Salit, Jacqueline; Mezey, Jason G; Leopold, Philip L; Crystal, Ronald G. Mandatory role of HMGA1 in human airway epithelial normal differentiation and post-injury regeneration. Oncotarget. 2018;9(18):14324-14337. PubMed |
| Walters, Matthew S; Gomi, Kazunori; Ashbridge, Beth; Moore, Malcolm A S; Arbelaez, Vanessa; Heldrich, Jonna; Ding, Bi-Sen; Rafii, Shahin; Staudt, Michelle R; Crystal, Ronald G. Generation of a human airway epithelium derived basal cell line with multipotent differentiation capacity. Respiratory Research. 2013;14(1):135. PubMed |
| Gomi, Kazunori; Arbelaez, Vanessa; Crystal, Ronald G; Walters, Matthew S. Activation of NOTCH1 or NOTCH3 signaling skews human airway basal cell differentiation toward a secretory pathway. Plos One. 10(2):e0116507. PubMed |
| Dougherty, Gerard W; Loges, Niki T; Klinkenbusch, Judith A; Olbrich, Heike; Pennekamp, Petra; Menchen, Tabea; Raidt, Johanna; Wallmeier, Julia; Werner, Claudius; Westermann, Cordula; Ruckert, Christian; Mirra, Virginia; Hjeij, Rim; Memari, Yasin; Durbin, Richard; Kolb-Kokocinski, Anja; Praveen, Kavita; Kashef, Mohammad A; Kashef, Sara; Eghtedari, Fardin; Häffner, Karsten; Valmari, Pekka; Baktai, György; Aviram, Micha; Bentur, Lea; Amirav, Israel; Davis, Erica E; Katsanis, Nicholas; Brueckner, Martina; Shaposhnykov, Artem; Pigino, Gaia; Dworniczak, Bernd; Omran, Heymut. DNAH11 Localization in the Proximal Region of Respiratory Cilia Defines Distinct Outer Dynein Arm Complexes. American Journal Of Respiratory Cell And Molecular Biology. 2016;55(2):213-24. PubMed |
| Whitfield, Marjorie; Thomas, Lucie; Bequignon, Emilie; Schmitt, Alain; Stouvenel, Laurence; Montantin, Guy; Tissier, Sylvie; Duquesnoy, Philippe; Copin, Bruno; Chantot, Sandra; Dastot, Florence; Faucon, Catherine; Barbotin, Anne Laure; Loyens, Anne; Siffroi, Jean-Pierre; Papon, Jean-François; Escudier, Estelle; Amselem, Serge; Mitchell, Valérie; Touré, Aminata; Legendre, Marie. Mutations in DNAH17, Encoding a Sperm-Specific Axonemal Outer Dynein Arm Heavy Chain, Cause Isolated Male Infertility Due to Asthenozoospermia. American Journal Of Human Genetics. 2019;105(1):198-212. PubMed |
| Simões, Filipa B; Quaresma, Margarida C; Clarke, Luka A; Silva, Iris Al; Pankonien, Ines; Railean, Violeta; Kmit, Arthur; Amaral, Margarida D. TMEM16A chloride channel does not drive mucus production. Life Science Alliance. 2019;2(6) PubMed |
| Thomas, Lucie; Bouhouche, Khaled; Whitfield, Marjorie; Thouvenin, Guillaume; Coste, Andre; Louis, Bruno; Szymanski, Claire; Bequignon, Emilie; Papon, Jean-François; Castelli, Manon; Lemullois, Michel; Dhalluin, Xavier; Drouin-Garraud, Valérie; Montantin, Guy; Tissier, Sylvie; Duquesnoy, Philippe; Copin, Bruno; Dastot, Florence; Couvet, Sandrine; Barbotin, Anne-Laure; Faucon, Catherine; Honore, Isabelle; Maitre, Bernard; Beydon, Nicole; Tamalet, Aline; Rives, Nathalie; Koll, France; Escudier, Estelle; Tassin, Anne-Marie; Touré, Aminata; Mitchell, Valérie; Amselem, Serge; Legendre, Marie. TTC12 Loss-of-Function Mutations Cause Primary Ciliary Dyskinesia and Unveil Distinct Dynein Assembly Mechanisms in Motile Cilia Versus Flagella. American Journal Of Human Genetics. 2020;106(2):153-169. PubMed |
| Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |
| McKenzie, Casey W; Lee, Lance. Genetic interaction between central pair apparatus genes CFAP221, CFAP54, and SPEF2 in mouse models of primary ciliary dyskinesia. Scientific Reports. 2020;10(1):12337. PubMed |
| Schultz, Rüdiger; Elenius, Varpu; Fassad, Mahmoud R; Freke, Grace; Rogers, Andrew; Shoemark, Amelia; Koistinen, Tiina; Mohamed, Mai A; Lim, Jacqueline S Y; Mitchison, Hannah M; Sironen, Anu I. CFAP300 mutation causing primary ciliary dyskinesia in Finland. Frontiers In Genetics. 13( 36246608):985227. PubMed |
| Al-Mutairi, Dalal A; Alsabah, Basel H; Alkhaledi, Bashar A; Pennekamp, Petra; Omran, Heymut. Identification of a novel founder variant in DNAI2 cause primary ciliary dyskinesia in five consanguineous families derived from a single tribe descendant of Arabian Peninsula. Frontiers In Genetics. 13( 36303540):1017280. PubMed |