Anti DNAH9 pAb (ATL-HPA052641 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052641-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DNAH9
Alternative Gene Name: DNAH17L, Dnahc9, DNAL1, DYH9, HL-20, HL20, KIAA0357
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056752: 80%, ENSRNOG00000004171: 77%
Entrez Gene ID: 1770
Uniprot ID: Q9NYC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLL |
| Gene Sequence | YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLL |
| Gene ID - Mouse | ENSMUSG00000056752 |
| Gene ID - Rat | ENSRNOG00000004171 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNAH9 pAb (ATL-HPA052641 w/enhanced validation) | |
| Datasheet | Anti DNAH9 pAb (ATL-HPA052641 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNAH9 pAb (ATL-HPA052641 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DNAH9 pAb (ATL-HPA052641 w/enhanced validation) | |
| Datasheet | Anti DNAH9 pAb (ATL-HPA052641 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNAH9 pAb (ATL-HPA052641 w/enhanced validation) |
| Citations for Anti DNAH9 pAb (ATL-HPA052641 w/enhanced validation) – 3 Found |
| Loges, Niki T; Antony, Dinu; Maver, Ales; Deardorff, Matthew A; Güleç, Elif Yýlmaz; Gezdirici, Alper; Nöthe-Menchen, Tabea; Höben, Inga M; Jelten, Lena; Frank, Diana; Werner, Claudius; Tebbe, Johannes; Wu, Kaman; Goldmuntz, Elizabeth; Čuturilo, Goran; Krock, Bryan; Ritter, Alyssa; Hjeij, Rim; Bakey, Zeineb; Pennekamp, Petra; Dworniczak, Bernd; Brunner, Han; Peterlin, Borut; Tanidir, Cansaran; Olbrich, Heike; Omran, Heymut; Schmidts, Miriam. Recessive DNAH9 Loss-of-Function Mutations Cause Laterality Defects and Subtle Respiratory Ciliary-Beating Defects. American Journal Of Human Genetics. 2018;103(6):995-1008. PubMed |
| Whitfield, Marjorie; Thomas, Lucie; Bequignon, Emilie; Schmitt, Alain; Stouvenel, Laurence; Montantin, Guy; Tissier, Sylvie; Duquesnoy, Philippe; Copin, Bruno; Chantot, Sandra; Dastot, Florence; Faucon, Catherine; Barbotin, Anne Laure; Loyens, Anne; Siffroi, Jean-Pierre; Papon, Jean-François; Escudier, Estelle; Amselem, Serge; Mitchell, Valérie; Touré, Aminata; Legendre, Marie. Mutations in DNAH17, Encoding a Sperm-Specific Axonemal Outer Dynein Arm Heavy Chain, Cause Isolated Male Infertility Due to Asthenozoospermia. American Journal Of Human Genetics. 2019;105(1):198-212. PubMed |
| Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |