Anti DNAH8 pAb (ATL-HPA028447)

Atlas Antibodies

Catalog No.:
ATL-HPA028447-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: dynein, axonemal, heavy chain 8
Gene Name: DNAH8
Alternative Gene Name: hdhc9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033826: 78%, ENSRNOG00000000542: 75%
Entrez Gene ID: 1769
Uniprot ID: Q96JB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETEEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLD
Gene Sequence ILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETEEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLD
Gene ID - Mouse ENSMUSG00000033826
Gene ID - Rat ENSRNOG00000000542
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAH8 pAb (ATL-HPA028447)
Datasheet Anti DNAH8 pAb (ATL-HPA028447) Datasheet (External Link)
Vendor Page Anti DNAH8 pAb (ATL-HPA028447) at Atlas Antibodies

Documents & Links for Anti DNAH8 pAb (ATL-HPA028447)
Datasheet Anti DNAH8 pAb (ATL-HPA028447) Datasheet (External Link)
Vendor Page Anti DNAH8 pAb (ATL-HPA028447)
Citations for Anti DNAH8 pAb (ATL-HPA028447) – 5 Found
Wang, Yu; Ledet, Russell J; Imberg-Kazdan, Keren; Logan, Susan K; Garabedian, Michael J. Dynein axonemal heavy chain 8 promotes androgen receptor activity and associates with prostate cancer progression. Oncotarget. 2016;7(31):49268-49280.  PubMed
Song, Feifeng; Zhang, Yiwen; Pan, Zongfu; Hu, Xiaoping; Yi, Yaodong; Zheng, Xiaochun; Wei, Haibin; Huang, Ping. Identification of novel key genes associated with the metastasis of prostate cancer based on bioinformatics prediction and validation. Cancer Cell International. 2021;21(1):559.  PubMed
Whitfield, Marjorie; Thomas, Lucie; Bequignon, Emilie; Schmitt, Alain; Stouvenel, Laurence; Montantin, Guy; Tissier, Sylvie; Duquesnoy, Philippe; Copin, Bruno; Chantot, Sandra; Dastot, Florence; Faucon, Catherine; Barbotin, Anne Laure; Loyens, Anne; Siffroi, Jean-Pierre; Papon, Jean-François; Escudier, Estelle; Amselem, Serge; Mitchell, Valérie; Touré, Aminata; Legendre, Marie. Mutations in DNAH17, Encoding a Sperm-Specific Axonemal Outer Dynein Arm Heavy Chain, Cause Isolated Male Infertility Due to Asthenozoospermia. American Journal Of Human Genetics. 2019;105(1):198-212.  PubMed
Aprea, Isabella; Nöthe-Menchen, Tabea; Dougherty, Gerard W; Raidt, Johanna; Loges, Niki T; Kaiser, Thomas; Wallmeier, Julia; Olbrich, Heike; Strünker, Timo; Kliesch, Sabine; Pennekamp, Petra; Omran, Heymut. Motility of efferent duct cilia aids passage of sperm cells through the male reproductive system. Molecular Human Reproduction. 2021;27(3)  PubMed
Aprea, Isabella; Raidt, Johanna; Höben, Inga Marlena; Loges, Niki Tomas; Nöthe-Menchen, Tabea; Pennekamp, Petra; Olbrich, Heike; Kaiser, Thomas; Biebach, Luisa; Tüttelmann, Frank; Horvath, Judit; Schubert, Maria; Krallmann, Claudia; Kliesch, Sabine; Omran, Heymut. Defects in the cytoplasmic assembly of axonemal dynein arms cause morphological abnormalities and dysmotility in sperm cells leading to male infertility. Plos Genetics. 2021;17(2):e1009306.  PubMed