Anti DNAH6 pAb (ATL-HPA061401)

Atlas Antibodies

Catalog No.:
ATL-HPA061401-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: dynein axonemal heavy chain 6
Gene Name: DNAH6
Alternative Gene Name: Dnahc6, DNHL1, FLJ37357, HL-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052861: 90%, ENSRNOG00000015581: 89%
Entrez Gene ID: 1768
Uniprot ID: Q9C0G6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NANLVFQYKETSTLINTILEVQPRSSTGGEGKSNDEIVQELVASVQTRVPEKLEMEGASESLFVKDLQGRLNSLTTVLG
Gene Sequence NANLVFQYKETSTLINTILEVQPRSSTGGEGKSNDEIVQELVASVQTRVPEKLEMEGASESLFVKDLQGRLNSLTTVLG
Gene ID - Mouse ENSMUSG00000052861
Gene ID - Rat ENSRNOG00000015581
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAH6 pAb (ATL-HPA061401)
Datasheet Anti DNAH6 pAb (ATL-HPA061401) Datasheet (External Link)
Vendor Page Anti DNAH6 pAb (ATL-HPA061401) at Atlas Antibodies

Documents & Links for Anti DNAH6 pAb (ATL-HPA061401)
Datasheet Anti DNAH6 pAb (ATL-HPA061401) Datasheet (External Link)
Vendor Page Anti DNAH6 pAb (ATL-HPA061401)