Anti DNAH6 pAb (ATL-HPA036391 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036391-25

• 

Protein Description: dynein, axonemal, heavy chain 6
Gene Name: DNAH6
Alternative Gene Name: Dnahc6, DNHL1, FLJ37357, HL-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052861: 93%, ENSRNOG00000015581: 89%
Entrez Gene ID: 1768
Uniprot ID: Q9C0G6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDDNPDARLPNSGDLWSIHMDFDTKRLDPWERIIPTFKYNRDVP
• Gene Sequence: TKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDDNPDARLPNSGDLWSIHMDFDTKRLDPWERIIPTFKYNRDVP
• Gene ID - Mouse: ENSMUSG00000052861
• Gene ID - Rat: ENSRNOG00000015581
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DNAH6 pAb (ATL-HPA036391 w/enhanced validation) – 1 Found

Oltean, Alina; Schaffer, Andrew J; Bayly, Philip V; Brody, Steven L. Quantifying Ciliary Dynamics during Assembly Reveals Stepwise Waveform Maturation in Airway Cells. American Journal Of Respiratory Cell And Molecular Biology. 2018;59(4):511-522.