Anti DNAH5 pAb (ATL-HPA037470 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037470-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: DNAH5
Alternative Gene Name: CILD3, Dnahc5, HL1, KTGNR, PCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022262: 83%, ENSRNOG00000048363: 83%
Entrez Gene ID: 1767
Uniprot ID: Q8TE73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPD |
| Gene Sequence | EVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPD |
| Gene ID - Mouse | ENSMUSG00000022262 |
| Gene ID - Rat | ENSRNOG00000048363 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNAH5 pAb (ATL-HPA037470 w/enhanced validation) | |
| Datasheet | Anti DNAH5 pAb (ATL-HPA037470 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNAH5 pAb (ATL-HPA037470 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DNAH5 pAb (ATL-HPA037470 w/enhanced validation) | |
| Datasheet | Anti DNAH5 pAb (ATL-HPA037470 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNAH5 pAb (ATL-HPA037470 w/enhanced validation) |
| Citations for Anti DNAH5 pAb (ATL-HPA037470 w/enhanced validation) – 17 Found |
| Shoemark, Amelia; Frost, Emily; Dixon, Mellisa; Ollosson, Sarah; Kilpin, Kate; Patel, Mitali; Scully, Juliet; Rogers, Andrew V; Mitchison, Hannah M; Bush, Andrew; Hogg, Claire. Accuracy of Immunofluorescence in the Diagnosis of Primary Ciliary Dyskinesia. American Journal Of Respiratory And Critical Care Medicine. 2017;196(1):94-101. PubMed |
| Mali, Girish R; Yeyati, Patricia L; Mizuno, Seiya; Dodd, Daniel O; Tennant, Peter A; Keighren, Margaret A; Zur Lage, Petra; Shoemark, Amelia; Garcia-Munoz, Amaya; Shimada, Atsuko; Takeda, Hiroyuki; Edlich, Frank; Takahashi, Satoru; von Kreigsheim, Alex; Jarman, Andrew P; Mill, Pleasantine. ZMYND10 functions in a chaperone relay during axonemal dynein assembly. Elife. 2018;7( 29916806) PubMed |
| Abdelhamed, Zakia A; Ryan, Thomas A; Fuller, Martin; Coulson-Gilmer, Camilla; Abdelmottaleb, Dina I; Wang, Tian-Li; Kaun, Jen-Chun; Wang, Peiyi; Hutson, Richard; Wilkinson, Nafisa; Bell, Sandra M; Johnson, Colin A. Characterization of Primary Cilia in Normal Fallopian Tube Epithelium and Serous Tubal Intraepithelial Carcinoma. International Journal Of Gynecological Cancer : Official Journal Of The International Gynecological Cancer Society. 2018;28(8):1535-1544. PubMed |
| Hawkins, Finn J; Suzuki, Shingo; Beermann, Mary Lou; Barillà, Cristina; Wang, Ruobing; Villacorta-Martin, Carlos; Berical, Andrew; Jean, J C; Le Suer, Jake; Matte, Taylor; Simone-Roach, Chantelle; Tang, Yang; Schlaeger, Thorsten M; Crane, Ana M; Matthias, Nadine; Huang, Sarah X L; Randell, Scott H; Wu, Joshua; Spence, Jason R; Carraro, Gianni; Stripp, Barry R; Rab, Andras; Sorsher, Eric J; Horani, Amjad; Brody, Steven L; Davis, Brian R; Kotton, Darrell N. Derivation of Airway Basal Stem Cells from Human Pluripotent Stem Cells. Cell Stem Cell. 2021;28(1):79-95.e8. PubMed |
| Lu, Chenyang; Yang, Danhui; Lei, Cheng; Wang, Rongchun; Guo, Ting; Luo, Hong. Identification of Two Novel DNAAF2 Variants in Two Consanguineous Families with Primary Ciliary Dyskinesia. Pharmacogenomics And Personalized Medicine. 14( 34785929):1415-1423. PubMed |
| Iouranova, Alexandra; Grun, Delphine; Rossy, Tamara; Duc, Julien; Coudray, Alexandre; Imbeault, Michael; de Tribolet-Hardy, Jonas; Turelli, Priscilla; Persat, Alexandre; Trono, Didier. KRAB zinc finger protein ZNF676 controls the transcriptional influence of LTR12-related endogenous retrovirus sequences. Mobile Dna. 2022;13(1):4. PubMed |
| Onoufriadis, Alexandros; Shoemark, Amelia; Munye, Mustafa M; James, Chela T; Schmidts, Miriam; Patel, Mitali; Rosser, Elisabeth M; Bacchelli, Chiara; Beales, Philip L; Scambler, Peter J; Hart, Stephen L; Danke-Roelse, Jeannette E; Sloper, John J; Hull, Sarah; Hogg, Claire; Emes, Richard D; Pals, Gerard; Moore, Anthony T; Chung, Eddie M K; Mitchison, Hannah M. Combined exome and whole-genome sequencing identifies mutations in ARMC4 as a cause of primary ciliary dyskinesia with defects in the outer dynein arm. Journal Of Medical Genetics. 2014;51(1):61-7. PubMed |
| Onoufriadis, Alexandros; Shoemark, Amelia; Schmidts, Miriam; Patel, Mitali; Jimenez, Gina; Liu, Hui; Thomas, Biju; Dixon, Mellisa; Hirst, Robert A; Rutman, Andrew; Burgoyne, Thomas; Williams, Christopher; Scully, Juliet; Bolard, Florence; Lafitte, Jean-Jacques; Beales, Philip L; Hogg, Claire; Yang, Pinfen; Chung, Eddie M K; Emes, Richard D; O'Callaghan, Christopher; Bouvagnet, Patrice; Mitchison, Hannah M. Targeted NGS gene panel identifies mutations in RSPH1 causing primary ciliary dyskinesia and a common mechanism for ciliary central pair agenesis due to radial spoke defects. Human Molecular Genetics. 2014;23(13):3362-74. PubMed |
| Diggle, Christine P; Moore, Daniel J; Mali, Girish; zur Lage, Petra; Ait-Lounis, Aouatef; Schmidts, Miriam; Shoemark, Amelia; Garcia Munoz, Amaya; Halachev, Mihail R; Gautier, Philippe; Yeyati, Patricia L; Bonthron, David T; Carr, Ian M; Hayward, Bruce; Markham, Alexander F; Hope, Jilly E; von Kriegsheim, Alex; Mitchison, Hannah M; Jackson, Ian J; Durand, Bénédicte; Reith, Walter; Sheridan, Eamonn; Jarman, Andrew P; Mill, Pleasantine. HEATR2 plays a conserved role in assembly of the ciliary motile apparatus. Plos Genetics. 2014;10(9):e1004577. PubMed |
| Dong, Frederick N; Amiri-Yekta, Amir; Martinez, Guillaume; Saut, Antoine; Tek, Julie; Stouvenel, Laurence; Lorès, Patrick; Karaouzène, Thomas; Thierry-Mieg, Nicolas; Satre, Véronique; Brouillet, Sophie; Daneshipour, Abbas; Hosseini, Seyedeh Hanieh; Bonhivers, Mélanie; Gourabi, Hamid; Dulioust, Emmanuel; Arnoult, Christophe; Touré, Aminata; Ray, Pierre F; Zhao, Haiqing; Coutton, Charles. Absence of CFAP69 Causes Male Infertility due to Multiple Morphological Abnormalities of the Flagella in Human and Mouse. American Journal Of Human Genetics. 2018;102(4):636-648. PubMed |
| Whitfield, Marjorie; Thomas, Lucie; Bequignon, Emilie; Schmitt, Alain; Stouvenel, Laurence; Montantin, Guy; Tissier, Sylvie; Duquesnoy, Philippe; Copin, Bruno; Chantot, Sandra; Dastot, Florence; Faucon, Catherine; Barbotin, Anne Laure; Loyens, Anne; Siffroi, Jean-Pierre; Papon, Jean-François; Escudier, Estelle; Amselem, Serge; Mitchell, Valérie; Touré, Aminata; Legendre, Marie. Mutations in DNAH17, Encoding a Sperm-Specific Axonemal Outer Dynein Arm Heavy Chain, Cause Isolated Male Infertility Due to Asthenozoospermia. American Journal Of Human Genetics. 2019;105(1):198-212. PubMed |
| Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |
| Guo, Ting; Lu, Chenyang; Yang, Danhui; Lei, Cheng; Liu, Ying; Xu, Yingjie; Yang, Binyi; Wang, Rongchun; Luo, Hong. Case Report: DNAAF4 Variants Cause Primary Ciliary Dyskinesia and Infertility in Two Han Chinese Families. Frontiers In Genetics. 13( 35903363):934920. PubMed |
| Oltean, Alina; Schaffer, Andrew J; Bayly, Philip V; Brody, Steven L. Quantifying Ciliary Dynamics during Assembly Reveals Stepwise Waveform Maturation in Airway Cells. American Journal Of Respiratory Cell And Molecular Biology. 2018;59(4):511-522. PubMed |
| Schultz, Rüdiger; Elenius, Varpu; Fassad, Mahmoud R; Freke, Grace; Rogers, Andrew; Shoemark, Amelia; Koistinen, Tiina; Mohamed, Mai A; Lim, Jacqueline S Y; Mitchison, Hannah M; Sironen, Anu I. CFAP300 mutation causing primary ciliary dyskinesia in Finland. Frontiers In Genetics. 13( 36246608):985227. PubMed |
| Xu, Yingjie; Yang, Binyi; Lei, Cheng; Yang, Danhui; Ding, Shuizi; Lu, Chenyang; Wang, Lin; Guo, Ting; Wang, Rongchun; Luo, Hong. Novel Compound Heterozygous Variants in CCDC40 Associated with Primary Ciliary Dyskinesia and Multiple Morphological Abnormalities of the Sperm Flagella. Pharmacogenomics And Personalized Medicine. 15( 35449766):341-350. PubMed |
| Al-Mutairi, Dalal A; Alsabah, Basel H; Alkhaledi, Bashar A; Pennekamp, Petra; Omran, Heymut. Identification of a novel founder variant in DNAI2 cause primary ciliary dyskinesia in five consanguineous families derived from a single tribe descendant of Arabian Peninsula. Frontiers In Genetics. 13( 36303540):1017280. PubMed |