Anti DNAH14 pAb (ATL-HPA027718)

Atlas Antibodies

Catalog No.:
ATL-HPA027718-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: dynein, axonemal, heavy chain 14
Gene Name: DNAH14
Alternative Gene Name: C1orf67, DKFZp781B1548, Dnahc14, HL-18, HL18, MGC27277
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047369: 61%, ENSRNOG00000015581: 50%
Entrez Gene ID: 127602
Uniprot ID: Q0VDD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FIIPSIDDISAQLEESQVILATIKGSPHIGPIKDLVNEWDQNLTLFSYTLEEWMNCQRNWLYLEPVFHSSEIRR
Gene Sequence FIIPSIDDISAQLEESQVILATIKGSPHIGPIKDLVNEWDQNLTLFSYTLEEWMNCQRNWLYLEPVFHSSEIRR
Gene ID - Mouse ENSMUSG00000047369
Gene ID - Rat ENSRNOG00000015581
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNAH14 pAb (ATL-HPA027718)
Datasheet Anti DNAH14 pAb (ATL-HPA027718) Datasheet (External Link)
Vendor Page Anti DNAH14 pAb (ATL-HPA027718) at Atlas Antibodies

Documents & Links for Anti DNAH14 pAb (ATL-HPA027718)
Datasheet Anti DNAH14 pAb (ATL-HPA027718) Datasheet (External Link)
Vendor Page Anti DNAH14 pAb (ATL-HPA027718)