Anti DNAH11 pAb (ATL-HPA056474)

Atlas Antibodies

Catalog No.: ATL-HPA056474-25

Protein Description: dynein, axonemal, heavy chain 11
Gene Name: DNAH11
Alternative Gene Name: CILD7, DNAHBL, Dnahc11, DNHBL, DPL11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018581: 72%, ENSRNOG00000005451: 71%
Entrez Gene ID: 8701
Uniprot ID: Q96DT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DCWGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNLVEENRKLFKANPSLDTWKI
• Gene Sequence: DCWGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNLVEENRKLFKANPSLDTWKI
• Gene ID - Mouse: ENSMUSG00000018581
• Gene ID - Rat: ENSRNOG00000005451
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DNAH11 pAb (ATL-HPA056474) – 1 Found

Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)