Anti DNAH10OS pAb (ATL-HPA039786)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039786-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DNAH10OS
Alternative Gene Name: FLJ45278
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029471: 31%, ENSRNOG00000029813: 36%
Entrez Gene ID:
Uniprot ID: P0CZ25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MVPESEWAPWQPQLPCEPKWLGSRKSKPHRESGLRGGGPSRCAKRGTHSCGPRESGGPDTCHL |
| Gene Sequence | MVPESEWAPWQPQLPCEPKWLGSRKSKPHRESGLRGGGPSRCAKRGTHSCGPRESGGPDTCHL |
| Gene ID - Mouse | ENSMUSG00000029471 |
| Gene ID - Rat | ENSRNOG00000029813 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNAH10OS pAb (ATL-HPA039786) | |
| Datasheet | Anti DNAH10OS pAb (ATL-HPA039786) Datasheet (External Link) |
| Vendor Page | Anti DNAH10OS pAb (ATL-HPA039786) at Atlas Antibodies |
| Documents & Links for Anti DNAH10OS pAb (ATL-HPA039786) | |
| Datasheet | Anti DNAH10OS pAb (ATL-HPA039786) Datasheet (External Link) |
| Vendor Page | Anti DNAH10OS pAb (ATL-HPA039786) |