Anti DNAH10OS pAb (ATL-HPA039786)

Atlas Antibodies

SKU: ATL-HPA039786-25

• 

Protein Description: dynein, axonemal, heavy chain 10 opposite strand
Gene Name: DNAH10OS
Alternative Gene Name: FLJ45278
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029471: 31%, ENSRNOG00000029813: 36%
Entrez Gene ID:
Uniprot ID: P0CZ25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVPESEWAPWQPQLPCEPKWLGSRKSKPHRESGLRGGGPSRCAKRGTHSCGPRESGGPDTCHL
• Gene Sequence: MVPESEWAPWQPQLPCEPKWLGSRKSKPHRESGLRGGGPSRCAKRGTHSCGPRESGGPDTCHL
• Gene ID - Mouse: ENSMUSG00000029471
• Gene ID - Rat: ENSRNOG00000029813
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.