Anti DNAAF2 pAb (ATL-HPA004113)

Atlas Antibodies

SKU:
ATL-HPA004113-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in leydig cells and subsets of cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dynein, axonemal, assembly factor 2
Gene Name: DNAAF2
Alternative Gene Name: C14orf104, CILD10, FLJ10563, KTU, PF13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020973: 68%, ENSRNOG00000028155: 76%
Entrez Gene ID: 55172
Uniprot ID: Q9NVR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEPLCPPLLCNQDKETLTLLIQVPRIQPQSLQGDLNPLWYKLRFSAQDLVYSFFLQFAPENKLSTTEPVISISSNNAVIELAKSPESHGHWREWYYGVNNDSLE
Gene Sequence GEPLCPPLLCNQDKETLTLLIQVPRIQPQSLQGDLNPLWYKLRFSAQDLVYSFFLQFAPENKLSTTEPVISISSNNAVIELAKSPESHGHWREWYYGVNNDSLE
Gene ID - Mouse ENSMUSG00000020973
Gene ID - Rat ENSRNOG00000028155
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNAAF2 pAb (ATL-HPA004113)
Datasheet Anti DNAAF2 pAb (ATL-HPA004113) Datasheet (External Link)
Vendor Page Anti DNAAF2 pAb (ATL-HPA004113) at Atlas Antibodies

Documents & Links for Anti DNAAF2 pAb (ATL-HPA004113)
Datasheet Anti DNAAF2 pAb (ATL-HPA004113) Datasheet (External Link)
Vendor Page Anti DNAAF2 pAb (ATL-HPA004113)



Citations for Anti DNAAF2 pAb (ATL-HPA004113) – 2 Found
Tarkar, Aarti; Loges, Niki T; Slagle, Christopher E; Francis, Richard; Dougherty, Gerard W; Tamayo, Joel V; Shook, Brett; Cantino, Marie; Schwartz, Daniel; Jahnke, Charlotte; Olbrich, Heike; Werner, Claudius; Raidt, Johanna; Pennekamp, Petra; Abouhamed, Marouan; Hjeij, Rim; Köhler, Gabriele; Griese, Matthias; Li, You; Lemke, Kristi; Klena, Nikolas; Liu, Xiaoqin; Gabriel, George; Tobita, Kimimasa; Jaspers, Martine; Morgan, Lucy C; Shapiro, Adam J; Letteboer, Stef J F; Mans, Dorus A; Carson, Johnny L; Leigh, Margaret W; Wolf, Whitney E; Chen, Serafine; Lucas, Jane S; Onoufriadis, Alexandros; Plagnol, Vincent; Schmidts, Miriam; Boldt, Karsten; Roepman, Ronald; Zariwala, Maimoona A; Lo, Cecilia W; Mitchison, Hannah M; Knowles, Michael R; Burdine, Rebecca D; Loturco, Joseph J; Omran, Heymut. DYX1C1 is required for axonemal dynein assembly and ciliary motility. Nature Genetics. 2013;45(9):995-1003.  PubMed
Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)  PubMed