Anti DNAAF1 pAb (ATL-HPA074239 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA074239-25

• 

Protein Description: dynein axonemal assembly factor 1
Gene Name: DNAAF1
Alternative Gene Name: CILD13, FLJ25330, LRRC50, ODA7, swt
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031831: 59%, ENSRNOG00000015590: 57%
Entrez Gene ID: 123872
Uniprot ID: Q8NEP3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFK
• Gene Sequence: SLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFK
• Gene ID - Mouse: ENSMUSG00000031831
• Gene ID - Rat: ENSRNOG00000015590
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.