Anti DNA2 pAb (ATL-HPA037487)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037487-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DNA2
Alternative Gene Name: DNA2L, KIAA0083
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036875: 74%, ENSRNOG00000000387: 69%
Entrez Gene ID: 1763
Uniprot ID: P51530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TVLSTGMDNRYLVLAVNTVQNKEGNCEKRLVITASQSLENKELCILRNDWCSVPVEPGDIIHLEGDCTSDTWIIDKDFGYLILY |
Gene Sequence | TVLSTGMDNRYLVLAVNTVQNKEGNCEKRLVITASQSLENKELCILRNDWCSVPVEPGDIIHLEGDCTSDTWIIDKDFGYLILY |
Gene ID - Mouse | ENSMUSG00000036875 |
Gene ID - Rat | ENSRNOG00000000387 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DNA2 pAb (ATL-HPA037487) | |
Datasheet | Anti DNA2 pAb (ATL-HPA037487) Datasheet (External Link) |
Vendor Page | Anti DNA2 pAb (ATL-HPA037487) at Atlas Antibodies |
Documents & Links for Anti DNA2 pAb (ATL-HPA037487) | |
Datasheet | Anti DNA2 pAb (ATL-HPA037487) Datasheet (External Link) |
Vendor Page | Anti DNA2 pAb (ATL-HPA037487) |