Anti DNA2 pAb (ATL-HPA037487)

Atlas Antibodies

SKU:
ATL-HPA037487-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic(granular pattern) positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DNA replication helicase/nuclease 2
Gene Name: DNA2
Alternative Gene Name: DNA2L, KIAA0083
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036875: 74%, ENSRNOG00000000387: 69%
Entrez Gene ID: 1763
Uniprot ID: P51530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVLSTGMDNRYLVLAVNTVQNKEGNCEKRLVITASQSLENKELCILRNDWCSVPVEPGDIIHLEGDCTSDTWIIDKDFGYLILY
Gene Sequence TVLSTGMDNRYLVLAVNTVQNKEGNCEKRLVITASQSLENKELCILRNDWCSVPVEPGDIIHLEGDCTSDTWIIDKDFGYLILY
Gene ID - Mouse ENSMUSG00000036875
Gene ID - Rat ENSRNOG00000000387
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNA2 pAb (ATL-HPA037487)
Datasheet Anti DNA2 pAb (ATL-HPA037487) Datasheet (External Link)
Vendor Page Anti DNA2 pAb (ATL-HPA037487) at Atlas Antibodies

Documents & Links for Anti DNA2 pAb (ATL-HPA037487)
Datasheet Anti DNA2 pAb (ATL-HPA037487) Datasheet (External Link)
Vendor Page Anti DNA2 pAb (ATL-HPA037487)